3.33 Rating by CuteStat

dmaservi.com is 6 years 2 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, dmaservi.com is SAFE to browse.

PageSpeed Score
100
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.185.108.139

Hosted Country:

United States of America US

Location Latitude:

29.8284

Location Longitude:

-95.4696

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.185.108.139)

Trick Photography Ideas

- trickphotographyideas.net

how to do trick photography and special effects review

Not Applicable $ 8.95

Trick Photography And Special Effects 2nd Edition Pdf

- trickphotographyandspecialeffectsreview.net

how to do trick photography and special effects

Not Applicable $ 8.95

Trick Photography

- trickphotographyspecialeffects.org

trick photography techniques how to shoot trick photos

Not Applicable $ 8.95

Trick Photography And Special Effects 2nd Edition Pdf

- trickphotographyandspecialeffectspdf.net

how to do trick photography and special effects

Not Applicable $ 8.95

Fundación Instituto Hipólito Unanue

- fihu-diagnostico.org.pe
1,357,204 $ 480.00

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.12.2
Date: Sun, 18 Mar 2018 22:02:48 GMT
Content-Type: text/html;charset=ISO-8859-1
Transfer-Encoding: chunked
Connection: keep-alive
Content-Encoding: gzip

Domain Information

Domain Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registration Date: Mar 17, 2018, 12:00 AM 6 years 2 months 4 weeks ago
Last Modified: Mar 17, 2018, 12:00 AM 6 years 2 months 4 weeks ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1509.websitewelcome.com 192.185.108.133 United States of America United States of America
ns1510.websitewelcome.com 192.185.108.134 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
dmaservi.com A 14399 IP: 192.185.108.139
dmaservi.com NS 86400 Target: ns1510.websitewelcome.com
dmaservi.com NS 86400 Target: ns1509.websitewelcome.com
dmaservi.com SOA 86400 MNAME: ns1509.websitewelcome.com
RNAME: ahdedios.hotmail.com
Serial: 2018031703
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
dmaservi.com MX 14400 Target: mail.dmaservi.com
dmaservi.com TXT 14400 TXT: v=spf1 a mx include:websitewelcome.com
~all

Full WHOIS Lookup

Domain Name: DMASERVI.COM
Registry Domain ID: 2240344254_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.PublicDomainRegistry.com
Registrar URL: http://www.publicdomainregistry.com
Updated Date: 2018-03-17T21:58:00Z
Creation Date: 2018-03-17T21:42:53Z
Registry Expiry Date: 2019-03-17T21:42:53Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1509.WEBSITEWELCOME.COM
Name Server: NS1510.WEBSITEWELCOME.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-03-18T22:02:38Z